PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888152.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 314aa    MW: 34719.3 Da    PI: 9.5783
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888152.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.32.3e-3549108261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++alkcprC+s+ntkfCyynny+ sqPr+fC++C+r+WtkGG+lrnvPvGggr+ ++ +
  XP_015888152.1  49 QSEALKCPRCESSNTKFCYYNNYNKSQPRHFCRTCKRHWTKGGTLRNVPVGGGRKIKRPK 108
                     67899************************************************9877755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.4E-3151104IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2252106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.08353107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGLSSKQVIS SDGLDWSRTF LQAQTNLQLP KSTSMRRQQQ QQQNQLQQQS EALKCPRCES  60
SNTKFCYYNN YNKSQPRHFC RTCKRHWTKG GTLRNVPVGG GRKIKRPKKS GSGTAATTSA  120
TATTTTTATA TTTSAAATGN SNTNGNRLST HLTFQGHEQQ RQSSVSLALG DEKNNVSEIF  180
YQALIRPPSL PQQNLIGSNS NINRSFLLSN LPSSQDQQSL NFPLISNSAS LDPKNSSIST  240
SFPTSNNVYN YVDHQDFKLM SEPSITGSTT QPWQIVTTTT SSGMDMSNYW NWEDIDNLVS  300
ADLNVPWDDS DIKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888152.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLV7CQU02e-87V7CQU0_PHAVU; Uncharacterized protein
STRINGVIT_00s0652g00010.t011e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-28DOF zinc finger protein 1